PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00031.1.g00980.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 506aa    MW: 56635.7 Da    PI: 7.1485
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00031.1.g00980.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS288.61.7e-88344654374
                          GRAS   4 lLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykal.ppsetseknsseelaalkl 83 
                                   +L ecA +v++g +  a+++L+r+  la+  + pm Rla  ++ ALa+ l+     + +al +ps+    ++ ++ aa+  
  Zjn_sc00031.1.g00980.1.am.mk  34 ALWECAAHVAAGRFDGASRCLERVLGLATIGDGPMPRLARILADALARCLLLRLGPVNRALiQPSAYL--DQRSVRAARYG 112
                                   699*********************************************99997888887774555554..33333345556 PP

                          GRAS  84 fsevsPilkfshltaNqaIleavegeervHiiDfd..isqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetg 162
                                   f+++ P+l++++++ N+aIl+a+++e+ vH+iD++  + ++ QW+ L++a++ Rp+g+p+l iT+v++    +   l  + 
  Zjn_sc00031.1.g00980.1.am.mk 113 FVKLLPFLRVAYVAINRAILDATDKEKYVHVIDLSgpAANPWQWLKLMRAMSRRPGGAPNLHITVVHD----DGVFLADMW 189
                                   **********************************866799****************************....9******** PP

                          GRAS 163 erLakfAeelgvpfefnvlvakrledleleeL....rvkpgEalaVnlvlqlhrll......................... 214
                                    rL+k Ae+l++ f f+     rle+l++++L    ++++g al  +++lq+h ll                         
  Zjn_sc00031.1.g00980.1.am.mk 190 ARLRKEAESLNMAFTFHG-FLGRLETLDFDKLhdvlDIRSGYALSFSCALQMHGLLavedaaavnvgtstqaswpsgasrf 269
                                   ******************.689999999999866668999***************************************** PP

                          GRAS 215 .................................desvsleserdevLklvkslsPkvvvvveqeadhnsesFlerfleale 262
                                                                      +  ++   +++ ++v+ +sPkv+vvveqea+hn+++F+ rf ea+ 
  Zjn_sc00031.1.g00980.1.am.mk 270 vrfaggqemnkrdvhpdpspttplcrvaptptpWPPSRVPPLLTRFQHAVRAVSPKVLVVVEQEANHNEPEFAVRFQEAFG 350
                                   *****************************9998334444445668************************************ PP

                          GRAS 263 yysalfdsleaklpres...eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqakll 340
                                   yy+alfd+l+  +++e    eer+ vE++llg+ei++v+  eg errerhe l++W +r+ +aGF+pvpls++a ++a+ +
  Zjn_sc00031.1.g00980.1.am.mk 351 YYAALFDALQDRAGPERqmhEERAQVEQVLLGEEIKDVLVREGMERRERHEPLHRWAARMAHAGFGPVPLSYEAKNEADEV 431
                                   *********55555444488************************************************************* PP

                          GRAS 341 lrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                   lrk + ++y+  e+ ++l+l+ ++rpL++vSaWr
  Zjn_sc00031.1.g00980.1.am.mk 432 LRKLALREYENREHGNCLLLCRSERPLYAVSAWR 465
                                   *****999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.3445445IPR005202Transcription factor GRAS
PfamPF035145.8E-8634465IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 506 aa     Download sequence    Send to blast
MTDHPASNAR QQPPQEQEDE EGRLAASLVH LPLALWECAA HVAAGRFDGA SRCLERVLGL  60
ATIGDGPMPR LARILADALA RCLLLRLGPV NRALIQPSAY LDQRSVRAAR YGFVKLLPFL  120
RVAYVAINRA ILDATDKEKY VHVIDLSGPA ANPWQWLKLM RAMSRRPGGA PNLHITVVHD  180
DGVFLADMWA RLRKEAESLN MAFTFHGFLG RLETLDFDKL HDVLDIRSGY ALSFSCALQM  240
HGLLAVEDAA AVNVGTSTQA SWPSGASRFV RFAGGQEMNK RDVHPDPSPT TPLCRVAPTP  300
TPWPPSRVPP LLTRFQHAVR AVSPKVLVVV EQEANHNEPE FAVRFQEAFG YYAALFDALQ  360
DRAGPERQMH EERAQVEQVL LGEEIKDVLV REGMERRERH EPLHRWAARM AHAGFGPVPL  420
SYEAKNEADE VLRKLALREY ENREHGNCLL LCRSERPLYA VSAWRPWTFE VLDSINMAVP  480
LPAGQGPSTW TWPQQQQQAP FHNFTG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-13311465221375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015619131.11e-125PREDICTED: scarecrow-like protein 3
TrEMBLG2XLK61e-130G2XLK6_ORYGL; Hypothetical_protein
STRINGBGIOSGA034521-PA1e-123(Oryza sativa Indica Group)
STRINGORGLA12G0021600.11e-123(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60438176
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.12e-71scarecrow-like 3